Description: Human CCL28 is chemokine that is constitutively expressed by epithelial cells in diverse mucosal tissues and is known to attract a variety of immune cell types including T-cell subsets and eosinophils through activation of the G protein-coupled receptors CCR10 and CCR3. CCL28 contains an extended C-terminal domain consisting of ~40 flexible amino acids. In addition to the two disulfide bonds that are conserved throughout the chemokine family, two additional cysteine residues at positions 30 and 80 form a novel disulfide linkage between the folded chemokine domain and the flexible C-terminus. Human CCL28 is expressed as an immature polypeptide 127 amino acids in length. Two different mature N-terminal sequences have been described due to uncertainty in the site of cleavage by signal peptidase. CCL28(4-108) is described in the NCIB GenPept entry as the mature form based on an ab initio prediction of the site of signal peptide cleavage. It consists of residues 23-127 of the expressed protein and may exhibit higher potency as a CCR10 agonist than the longer version [CCL28(1-108)] that includes three additional N-terminal residues.
Amino Acid Sequence:
ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKV
QAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Molecular Weight:
12070 Daltons
Fusion Tag:
N/A
Special Characteristic(s):
Purity:
Purity assessed by HPLC, Mass Spectrometry, and NMR*
Source:
Human protein expressed in E. coli
Physical Form:
Lyophilized
Solubility:
Freely soluble in water **
Storage Conditions:
Product Form
Temperature
Storage Time
-20C to -80C
12 months
4C
6 months
RT
1 month
Additional comments or descriptive information:
* All recombinant proteins produced and sold by Protein Foundry, LLC are endotoxin-free <0.01 EU/ug of protein and validated using RP-HPLC, 2D-NMR, and functional reporter assay where available.
** Avoid repeated freeze-thaw cycles after reconstitution