Description: C-C motif chemokine 20 (CCL20), also known as liver activation regulated chemokine (LARC), Macrophage Inflammatory Protein-3 alpha (MIP-3 alpha), or Exodus, is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. CCL20 is a ligand for the G protein-coupled receptor CCR6, and induces chemotactic migration in a wide range of CCR6-expressing cells including immature dendritic cells (DC), effector/memory T-cells and B-cells. CCL20 is implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells towards the epithelial cells surrounding these tissues. CCL20 is expressed in the skin and contributes to the chronic inflammation of psoriasis.
Amino Acid Sequence:
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCAN
PKQTWVKYIVRLLSKKVKNM
Molecular Weight:
8025.5 Daltons
Fusion Tag:
N/A
Special Characteristic(s):
Purity:
Purity assessed by HPLC, Mass Spectrometry, and NMR*
Source:
Human protein expressed in E. coli
Physical Form:
Lyophilized
Solubility:
Freely soluble in water **
Storage Conditions:
Product Form
Temperature
Storage Time
-20C to -80C
12 months
4C
6 months
RT
1 month
Additional comments or descriptive information:
* All recombinant proteins produced and sold by Protein Foundry, LLC are endotoxin-free <0.01 EU/ug of protein and validated using RP-HPLC, 2D-NMR, and functional reporter assay where available.
** Avoid repeated freeze-thaw cycles after reconstitution
View CartItems0